| # | Country | Total Patents | |
|---|---|---|---|
| #1 | EPO (European Patent Office) | 4 | |
| #2 | WIPO (World Intellectual Property Organization) | 3 | |
| #3 | Canada | 2 | |
| #4 | China | 2 | |
| #5 | United States | 2 | |
| #6 | South Africa | 2 | |
| #7 | Australia | 1 | |
| #8 | Germany | 1 |
| # | Industry | |
|---|---|---|
| #1 | Pharmaceuticals | |
| #2 | Measurement | |
| #3 | Biotechnology |
| # | Technology | |
|---|---|---|
| #1 | Analysing materials | |
| #2 | Peptides | |
| #3 | Medical preparations | |
| #4 | Therapeutic chemical compounds |
| # | Name | Total Patents |
|---|---|---|
| #1 | Noll Franz | 5 |
| #2 | Nicolau Yves Claude | 5 |
| #3 | Greferath Ruth | 5 |
| #4 | Kapetanovic Ernest | 3 |
| #5 | Diaz-Carballo David | 2 |
| #6 | Seeber Siegfried | 2 |
| #7 | Hilger Ralf Axel | 2 |
| #8 | Nolls Franz | 2 |
| #9 | Yastas Samir | 2 |
| #10 | Bilstein Andreas | 2 |
| Publication | Filing date | Title |
|---|---|---|
| WO2008064903A2 | Antibody to the epitope grwirtqqhyyerdpkriyylslefymgrtlqntm or ifnqkivngwqveeaddwlrygnpwekarp or glgdvaevrksfnrhlhftlvkdrnvatprdyffa or dsmatlglaaygygiryefg | |
| AU2002346529A1 | Immunoassay and kit for an early and simulataneous detection of biochemical markers in a patient's sample | |
| US7199161B2 | Substituted bicylo[3.3.1]nonan-2,4,9-triones as pharmaceutical active ingredients | |
| EP1448601A2 | Methods and compostions of monoclonal antibodies specific for beta-amyloid proteins |